PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0002s0323.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 294aa    MW: 32191 Da    PI: 8.3824
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0002s0323.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.27.6e-332275255
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         prlrWtpeLH++Fv+a+e+LGG+ekAtPk +++lm+v gLt++hvkSHLQ+YR+
  Kalax.0002s0323.1.p 22 PRLRWTPELHSCFVQAIERLGGQEKATPKLVMQLMDVRGLTISHVKSHLQMYRS 75
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.6061878IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-311878IPR009057Homeodomain-like
SuperFamilySSF466898.96E-162077IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-242276IPR006447Myb domain, plants
PfamPF002491.1E-82374IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MVSCGRSGSG GGVRQYVRSK VPRLRWTPEL HSCFVQAIER LGGQEKATPK LVMQLMDVRG  60
LTISHVKSHL QMYRSMKSDL SRQADLNSSH LGKHSFEDHD GDVDEEQDDG HQMKLQHHYS  120
SKPTSESDSH LVYNINPPKR ARFEMSGARS RAVVPDHRQG GGIYDTFIIS AAGPSSSSTT  180
STMLLSQNPY NSSINAPLGF PVKESDFLQA VNKVDKNGCR RRMICNAEAE DGPIRLSLSL  240
SLFHPSTNRS VTSSTSEASE TIISSPAYSK GCSNSFTDQQ SVNLDLSLAL CRT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002281928.16e-76PREDICTED: myb family transcription factor APL isoform X2
RefseqXP_010651000.16e-76PREDICTED: putative Myb family transcription factor At1g14600 isoform X1
TrEMBLD7SMG87e-76D7SMG8_VITVI; Putative uncharacterized protein
STRINGVIT_01s0137g00050.t012e-75(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.11e-28G2-like family protein